Mouse Anti-GZMB Antibody (CBMOAB-44306FYA)


Cat: CBMOAB-44306FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44306FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO44306FYA 100 µg
MO-AB-03746W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03746W 100 µg
MO-AB-26197H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26197C 100 µg
MO-AB-26272R Monoclonal Pig (Sus scrofa) WB, ELISA MO26272R 100 µg
MO-AB-56538W Monoclonal Marmoset WB, ELISA MO56538W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO44306FYA
SpecificityThis antibody binds to Rhesus GZMB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis.
Product OverviewMouse Anti-Rhesus GZMB Antibody is a mouse antibody against GZMB. It can be used for GZMB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGranzyme B; GZMB
UniProt IDH9Z885
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MQPILLLLAFLLLRRTDAGEIIGGHEAKPHSRPYMAYLMIWDQMSLKSCGGFLIREDFVLTAAHCWGSSINVTLGAHNIKEQERTQQIIPVKRAIPHPAYNPENFSNDIMLLQLERKAKRTTAVKPLRLPRNKAQVKPGQACDVAGWGQTTPDGKYAHTLQEVKLTVEEDQTCKSRLGHYYDSTVELCVGDPEIQKASFKGDSGGPLVCNKVAQGIVSYGQRNGKPPRVCTKVSSFVRWIKKTMKRH.
For Research Use Only | Not For Clinical Use.
Online Inquiry