Mouse Anti-H3C13 Antibody (MO-AB-13457W)


Cat: MO-AB-13457W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13457W Monoclonal Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris) WB, ELISA MO13457W 100 µg
MO-AB-31075W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31075W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Dog (Canis lupus familiaris)
CloneMO13457W
SpecificityThis antibody binds to Chimpanzee H3C13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee H3C13 Antibody is a mouse antibody against H3C13. It can be used for H3C13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H3; LOC746430; HIST2H3C
UniProt IDH2R5Q1
Protein RefseqThe length of the protein is 136 amino acids long.
The sequence is show below: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA.
For Research Use Only | Not For Clinical Use.
Online Inquiry