Mouse Anti-Hamsters abcc1 Antibody (MO-AB-42897W)


Cat: MO-AB-42897W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHamsters (Cricetinae)
CloneMO42897W
SpecificityThis antibody binds to Hamsters abcc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.
Product OverviewMouse Anti-Hamsters abcc1 Antibody is a mouse antibody against abcc1. It can be used for abcc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMultidrug resistance-associated protein 1; abcc1
UniProt IDQ7TNW1
Protein RefseqThe length of the protein is227 amino acids long.
The sequence is show below: EMGSYQELLDQDGAFAEFLRTYASAEQDLASEDNSVSGSGKESKPVENGLLVTVGKYPQRHLSSSSSHSGDAGQQHSSTAELQKAGAKEKAWKLMEVDKAQTGQVQLSVYWDYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDHPTVNGTQEHRTYRLSVYGALGILQGVSVFGYSMAVSIGGIFASRHLHLDLLRNVLRSPMSFFERTPSGNLVNRFSKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry