Mouse Anti-HAVCR2 Antibody (CBMOAB-44379FYA)


Cat: CBMOAB-44379FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44379FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO44379FYA 100 µg
CBMOAB-79105FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79105FYA 100 µg
MO-AB-13548R Monoclonal Cattle (Bos taurus) WB, ELISA MO13548R 100 µg
MO-AB-26232H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26232C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO44379FYA
SpecificityThis antibody binds to Rhesus HAVCR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Plasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas, Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. This protein is a Th1-specific cell surface protein that regulates macrophage activation, and inhibits Th1-mediated auto- and alloimmune responses, and promotes immunological tolerance. (From NCBI)
Product OverviewMouse Anti-Rhesus HAVCR2 Antibody is a mouse antibody against HAVCR2. It can be used for HAVCR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHAVCR2
UniProt IDF7GB92
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: MFSHLPFDCVLLLLLLLLTRSSEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNLKLVVIKPGGWTFACLLYE.
For Research Use Only | Not For Clinical Use.
Online Inquiry