Mouse Anti-HHAT Antibody (CBMOAB-44519FYA)


Cat: CBMOAB-44519FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44519FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO44519FYA 100 µg
CBMOAB-79417FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79417FYA 100 µg
MO-AB-20095W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20095W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO44519FYA
SpecificityThis antibody binds to Rhesus HHAT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSkinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725).
Product OverviewMouse Anti-Rhesus HHAT Antibody is a mouse antibody against HHAT. It can be used for HHAT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHHAT
UniProt IDF7GL47
Protein RefseqThe length of the protein is 183 amino acids long.
The sequence is show below: MRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHKFLIRYVYIPVGGSQHGLLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVEIPCIQDSLTRYFSPQARHRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYSHVGIAWAQTYAMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry