Mouse Anti-HLA-DMA Antibody (CBMOAB-44603FYA)


Cat: CBMOAB-44603FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44603FYA Monoclonal Rhesus (Macaca mulatta), Rabbit (Oryctolagus cuniculus) WB, ELISA MO44603FYA 100 µg
MO-AB-08364Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08364Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rabbit (Oryctolagus cuniculus)
CloneMO44603FYA
SpecificityThis antibody binds to Rhesus HLA-DMA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail.
Product OverviewMouse Anti-Rhesus HLA-DMA Antibody is a mouse antibody against HLA-DMA. It can be used for HLA-DMA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHLA class II histocompatibility antigen, DM alpha chain; HLA-DMA
UniProt IDH9F465
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: ADWAQEQGDAPAILFDKAFCEMMIQQIGPQLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGSGPTFVSAVDGLSFQAFSYLNITPEPSDIFSCIVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry