Mouse Anti-HLA-DMA Antibody (CBMOAB-44603FYA)


Cat: CBMOAB-44603FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44603FYA Monoclonal Rhesus (Macaca mulatta), Rabbit (Oryctolagus cuniculus) WB, ELISA MO44603FYA 100 µg
MO-AB-08364Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08364Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rabbit (Oryctolagus cuniculus)
CloneMO44603FYA
SpecificityThis antibody binds to Rhesus HLA-DMA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HLA-DMA Antibody is a mouse antibody against HLA-DMA. It can be used for HLA-DMA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHLA class II histocompatibility antigen, DM alpha chain; HLA-DMA
UniProt IDH9F465
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: ADWAQEQGDAPAILFDKAFCEMMIQQIGPQLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGSGPTFVSAVDGLSFQAFSYLNITPEPSDIFSCIVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry