Mouse Anti-HLA-DQB1 Antibody (CBMOAB-44605FYA)


Cat: CBMOAB-44605FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44605FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) WB, ELISA MO44605FYA 100 µg
MO-AB-15049Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15049Y 100 µg
MO-AB-25050W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25050W 100 µg
MO-AB-56795W Monoclonal Marmoset WB, ELISA MO56795W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries)
CloneMO44605FYA
SpecificityThis antibody binds to Rhesus HLA-DQB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HLA-DQB1 Antibody is a mouse antibody against HLA-DQB1. It can be used for HLA-DQB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHLA-DQB1
UniProt IDH9H456
Protein RefseqThe length of the protein is 132 amino acids long.
The sequence is show below: VEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGIVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQRPITVEWRAQSESAQSKMLSGVGGFVLGLIFLGLGLIIHHRSQKG.
For Research Use Only | Not For Clinical Use.
Online Inquiry