Mouse Anti-HLA-DQB1 Antibody (CBMOAB-44605FYA)
Cat: CBMOAB-44605FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44605FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) | WB, ELISA | MO44605FYA | 100 µg | ||
| MO-AB-15049Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15049Y | 100 µg | ||
| MO-AB-25050W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25050W | 100 µg | ||
| MO-AB-56795W | Monoclonal | Marmoset | WB, ELISA | MO56795W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) |
| Clone | MO44605FYA |
| Specificity | This antibody binds to Rhesus HLA-DQB1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Rhesus HLA-DQB1 Antibody is a mouse antibody against HLA-DQB1. It can be used for HLA-DQB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | HLA-DQB1 |
| UniProt ID | H9H456 |
| Protein Refseq | The length of the protein is 132 amino acids long. The sequence is show below: VEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGIVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQRPITVEWRAQSESAQSKMLSGVGGFVLGLIFLGLGLIIHHRSQKG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry