Mouse Anti-HLA-DRB1 Antibody (CBMOAB-44616FYA)
Cat: CBMOAB-44616FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44616FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) | WB, ELISA | MO44616FYA | 100 µg | ||
| MO-AB-16996Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16996Y | 100 µg | ||
| MO-AB-25919W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25919W | 100 µg | ||
| MO-AB-26908W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26908W | 100 µg | ||
| MO-AB-56803W | Monoclonal | Marmoset | WB, ELISA | MO56803W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) |
| Clone | MO44616FYA |
| Specificity | This antibody binds to Rhesus HLA-DRB1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. |
| Product Overview | Mouse Anti-Rhesus HLA-DRB1 Antibody is a mouse antibody against HLA-DRB1. It can be used for HLA-DRB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | MHC class II DR beta 1; HLA-DRB1 |
| UniProt ID | O19287 |
| Protein Refseq | The length of the protein is 82 amino acids long. The sequence is show below: LEQVKHECRFFNGTERVRYLERHFYNQEEFLHFDSDLGEFRAVTELGRPDAQYLNSQKDLLEDRRAGVDTYCRHNYGVFESF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry