AibGenesis™ Mouse Anti-HLA-DRB1 Antibody (CBMOAB-44616FYA)
Cat: CBMOAB-44616FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44616FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) | WB, ELISA | MO44616FYA | 100 µg | ||
| MO-AB-16996Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16996Y | 100 µg | ||
| MO-AB-25919W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25919W | 100 µg | ||
| MO-AB-26908W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26908W | 100 µg | ||
| MO-AB-56803W | Monoclonal | Marmoset | WB, ELISA | MO56803W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) |
| Clone | MO44616FYA |
| Specificity | This antibody binds to Rhesus HLA-DRB1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus HLA-DRB1 Antibody is a mouse antibody against HLA-DRB1. It can be used for HLA-DRB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | MHC class II DR beta 1; HLA-DRB1 |
| UniProt ID | O19287 |
| Protein Refseq | The length of the protein is 82 amino acids long. The sequence is show below: LEQVKHECRFFNGTERVRYLERHFYNQEEFLHFDSDLGEFRAVTELGRPDAQYLNSQKDLLEDRRAGVDTYCRHNYGVFESF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry