AibGenesis™ Mouse Anti-HMGB1 Antibody (CBMOAB-34636FYC)


Cat: CBMOAB-34636FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34636FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Horse (Equus caballus), E. coli (Escherichia coli), O. mykiss (Oncorhynchus mykiss), Pig, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, ELISA MO34636FC 100 µg
CBMOAB-44643FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO44643FYA 100 µg
MO-AB-70607W Monoclonal Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus) ELISA, WB M70607W 100 µg
MO-NAB-00144W Monoclonal Human (Homo sapiens), E. coli (Escherichia coli) WB, ChIP, ELISA, IF, IHC, IHC-P, S-ELISA, Neut, KD NW0080 100 µg
MO-AB-31132W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31132W 100 µg
MO-AB-45038W Monoclonal Horse (Equus caballus) WB, ELISA MO45038W 100 µg
MO-AB-13700R Monoclonal Cattle (Bos taurus) WB, ELISA MO13700R 100 µg
MO-AB-26343R Monoclonal Pig (Sus scrofa) WB, ELISA MO26343R 100 µg
MO-AB-04275H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04275C 100 µg
MO-AB-26317H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26317C 100 µg
MO-AB-08367Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08367Y 100 µg
MO-AB-11630Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11630Y 100 µg
MOFAB-795W Monoclonal Pig WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Horse (Equus caballus), E. coli (Escherichia coli), O. mykiss (Oncorhynchus mykiss), Pig, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta)
CloneMO34636FC
SpecificityThis antibody binds to Arabidopsis HMGB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. (From NCBI)
Product OverviewMouse Anti-Arabidopsis HMGB1 Antibody is a mouse antibody against HMGB1. It can be used for HMGB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHigh Mobility Group Box 1; High-Mobility Group (Nonhistone Chromosomal) Protein 1; Sulfoglucuronyl Carbohydrate Binding Protein; High Mobility Group Protein 1; Amphoterin; HMG-1
UniProt IDO49595
Protein RefseqThe length of the protein is 178 amino acids long. The sequence is show below: MKTAKGKDKVKTTKEALKPVDDRKVGKRKAPAEKPTKRETRKEKKAKKDPNKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAAKRKAEYEKQMDAYNKNLEEGSDESEKSRSEINDEDEASGEEELLEKEAAGDDEEEEEEEDDDDDDDEEED.
For Research Use Only | Not For Clinical Use.
Online Inquiry