Mouse Anti-HMGB1 Antibody (CBMOAB-34636FYC)
Cat: CBMOAB-34636FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-34636FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Horse (Equus caballus), E. coli (Escherichia coli), O. mykiss (Oncorhynchus mykiss), Pig, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) | WB, ELISA | MO34636FC | 100 µg | ||
| CBMOAB-44643FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44643FYA | 100 µg | ||
| MO-AB-70607W | Monoclonal | Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus) | ELISA, WB | M70607W | 100 µg | ||
| MO-NAB-00144W | Monoclonal | Human (Homo sapiens), E. coli (Escherichia coli) | WB, ChIP, ELISA, IF, IHC, IHC-P, S-ELISA, Neut, KD | NW0080 | 100 µg | ||
| MO-AB-31132W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31132W | 100 µg | ||
| MO-AB-45038W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45038W | 100 µg | ||
| MO-AB-13700R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13700R | 100 µg | ||
| MO-AB-26343R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26343R | 100 µg | ||
| MO-AB-04275H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04275C | 100 µg | ||
| MO-AB-26317H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26317C | 100 µg | ||
| MO-AB-08367Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08367Y | 100 µg | ||
| MO-AB-11630Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11630Y | 100 µg | ||
| MOFAB-795W | Monoclonal | Pig | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Horse (Equus caballus), E. coli (Escherichia coli), O. mykiss (Oncorhynchus mykiss), Pig, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) |
| Clone | MO34636FC |
| Specificity | This antibody binds to Arabidopsis HMGB1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. |
| Product Overview | Mouse Anti-Arabidopsis HMGB1 Antibody is a mouse antibody against HMGB1. It can be used for HMGB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | High Mobility Group Box 1; High-Mobility Group (Nonhistone Chromosomal) Protein 1; Sulfoglucuronyl Carbohydrate Binding Protein; High Mobility Group Protein 1; Amphoterin; HMG-1 |
| UniProt ID | O49595 |
| Protein Refseq | The length of the protein is 178 amino acids long. The sequence is show below: MKTAKGKDKVKTTKEALKPVDDRKVGKRKAPAEKPTKRETRKEKKAKKDPNKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAAKRKAEYEKQMDAYNKNLEEGSDESEKSRSEINDEDEASGEEELLEKEAAGDDEEEEEEEDDDDDDDEEED. |
For Research Use Only | Not For Clinical Use.
Online Inquiry