Mouse Anti-Horse ABCB1 Antibody (MO-AB-43543W)


Cat: MO-AB-43543W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43543W
SpecificityThis antibody binds to Horse ABCB1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. Mutations in this gene are associated with colchicine resistance and Inflammatory bowel disease 13. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Product OverviewMouse Anti-Horse ABCB1 (clone MO43543W) Antibody (MO-AB-43543W) is a mouse antibody against ABCB1. It can be used for ABCB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesP-glycoprotein; ABCB1
UniProt IDV5REV0
Protein RefseqThe length of the protein is296 amino acids long.
The sequence is show below: NFQDVLLVFSAIVFGAMAVGQVSSFAPDYAKAKVSAAHIIMIIEKTPLIDSYSTEGLKPNTLEGNVIFNEVVFNYPTRPDIPVLQGLSVEVKKGQTLALVGXSGCGKSTLVQLLERFYDPMAGTVLLDGTEIKHLNVQWLRAHLGIVSQEPILFDCSIGENIAYGDNSRVVSQEEIVQAAKEANIHPFIETLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPQILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGKVKERGTHQQLLAQKG.
For Research Use Only | Not For Clinical Use.

Online Inquiry