Mouse Anti-Horse Abcc13 Antibody (MO-AB-43546W)


Cat: MO-AB-43546W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43546W
SpecificityThis antibody binds to Horse Abcc13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the superfamily of genes encoding ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This family member is part of the MRP subfamily, which is involved in multi-drug resistance, but the human locus is now thought to be a pseudogene incapable of encoding a functional ABC protein. Alternative splicing results in multiple transcript variants; however, not all variants have been fully described.
Product OverviewMouse Anti-Horse Abcc13 Antibody is a mouse antibody against Abcc13. It can be used for Abcc13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette sub-family C member 13; Abcc13
UniProt IDQ6VBM3
Protein RefseqThe length of the protein is61 amino acids long.
The sequence is show below: KKFSTGEIINLMSADAQQLMDLTANLNLLWSAPFQILVAVSLLWQELGPAVLAGVAVLVFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry