Mouse Anti-Horse ACE Antibody (MO-AB-43553W)
Cat: MO-AB-43553W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO43553W |
Specificity | This antibody binds to Horse ACE. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, and two most abundant spliced variants encode the somatic form and the testicular form, respectively, that are equally active. |
Product Overview | Mouse Anti-Horse ACE Antibody is a mouse antibody against ACE. It can be used for ACE detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Angiotensin-converting enzyme; ACE |
UniProt ID | Q9MZ24 |
Protein Refseq | The length of the protein is39 amino acids long. The sequence is show below: ESPTFMEDLEHLYHQLEPLYLNLHAYVRRALHRRYGDRY. |
See other products for " ACE "
MO-AB-07056Y | Mouse Anti-Rabbit ACE Antibody (MO-AB-07056Y) |
MO-AB-14064Y | Mouse Anti-Sheep Ace Antibody (MO-AB-14064Y) |
MO-AB-00905W | Mouse Anti-Rhesus ACE Antibody (MO-AB-00905W) |
MO-AB-27162W | Mouse Anti-Chimpanzee ACE Antibody (MO-AB-27162W) |
MO-AB-06874R | Mouse Anti-Cattle ACE Antibody (MO-AB-06874R) |
MOFAB-095W | Mouse Anti-ACE Antibody (MOFAB-095W) |
MO-AB-68743W | Mouse Anti-Silkworm ace Antibody (MO-AB-68743W) |
MO-AB-00021Y | Mouse Anti-Chicken ACE Antibody (MO-AB-00021Y) |
CBMOAB-64621FYA | Mouse Anti-Zebrafish ace Antibody (CBMOAB-64621FYA) |
CBMOAB-00537FYA | Mouse Anti-D. melanogaster Ace Antibody (CBMOAB-00537FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry