Mouse Anti-Horse ADH5 Antibody (MO-AB-43584W)


Cat: MO-AB-43584W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43584W
SpecificityThis antibody binds to Horse ADH5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
Product OverviewMouse Anti-Horse ADH5 Antibody is a mouse antibody against ADH5. It can be used for ADH5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlcohol dehydrogenase class-3; EC 1.1.1.1; Alcohol dehydrogenase 5; Alcohol dehydrogenase class-III; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; EC 1.1.1.-; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.284; ADH5
UniProt IDP19854
Protein RefseqThe length of the protein is374 amino acids long.
The sequence is show below: MSAEVIKCKAAVAWEAGKPVSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGSFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPQTNLCQKIRTTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGVSTGYGAAVNTAKVEPGSTCAIFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFAKAKEFGASECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESIPKLVSEYMSKKIKVDEFVTHSLSFDQINEAFELMHAGKSIRTVVKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry