Mouse Anti-Horse ALDH2 Antibody (MO-AB-43631W)
Cat: MO-AB-43631W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO43631W |
Specificity | This antibody binds to Horse ALDH2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of East Asians have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among East Asians than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Product Overview | Mouse Anti-Horse ALDH2 Antibody is a mouse antibody against ALDH2. It can be used for ALDH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Aldehyde dehydrogenase, mitochondrial; EC 1.2.1.3; ALDH class 2; ALDH-E2; ALDHI; ALDH2 |
UniProt ID | P12762 |
Protein Refseq | The length of the protein is500 amino acids long. The sequence is show below: AAAATQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAAGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAAKLGPALATGNVVVMKVAEQTPLTALYVANLTKEAGFPPGVVNVVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGRSNLKKVTLELGGKSPNIIVSDADMDWAVEQAHFALFFNQGQCCGAGSRTFVQEDVYAEFVERSVARAKSRVVGNPFDSQTEQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKNS. |
See other products for " ALDH2 "
MO-AB-23676R | Mouse Anti-Pig ALDH2 Antibody (MO-AB-23676R) |
MOF032922W144 | Mouse Anti-ALDH2 Antibody (MOF032922W144) |
MO-AB-50699W | Mouse Anti-Marmoset ALDH2 Antibody (MO-AB-50699W) |
MO-AB-01353H | Mouse Anti-Frog aldh2 Antibody (MO-AB-01353H) |
MO-AB-07224R | Mouse Anti-Cattle ALDH2 Antibody (MO-AB-07224R) |
MO-AB-24028H | Mouse Anti-Rat Aldh2 Antibody (MO-AB-24028H) |
MO-AB-00042R | Mouse Anti-Medaka Aldh2 Antibody (MO-AB-00042R) |
MO-AB-17240W | Mouse Anti-Chimpanzee ALDH2 Antibody (MO-AB-17240W) |
CBMOAB-35489FYA | Mouse Anti-Rhesus ALDH2 Antibody (CBMOAB-35489FYA) |
MO-AB-01010W | Mouse Anti-Rhesus ALDH2 Antibody (MO-AB-01010W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry