Mouse Anti-Horse ALDH2 Antibody (MO-AB-43631W)


Cat: MO-AB-43631W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43631W
SpecificityThis antibody binds to Horse ALDH2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of East Asians have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among East Asians than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Horse ALDH2 Antibody is a mouse antibody against ALDH2. It can be used for ALDH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAldehyde dehydrogenase, mitochondrial; EC 1.2.1.3; ALDH class 2; ALDH-E2; ALDHI; ALDH2
UniProt IDP12762
Protein RefseqThe length of the protein is500 amino acids long.
The sequence is show below: AAAATQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAAGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAAKLGPALATGNVVVMKVAEQTPLTALYVANLTKEAGFPPGVVNVVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGRSNLKKVTLELGGKSPNIIVSDADMDWAVEQAHFALFFNQGQCCGAGSRTFVQEDVYAEFVERSVARAKSRVVGNPFDSQTEQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry