Mouse Anti-Horse BCAT1 Antibody (MO-AB-43840W)


Cat: MO-AB-43840W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43840W
SpecificityThis antibody binds to Horse BCAT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders. Alternatively spliced transcript variants have been described.
Product OverviewMouse Anti-Horse BCAT1 Antibody is a mouse antibody against BCAT1. It can be used for BCAT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBranched-chain-amino-acid aminotransferase; EC 2.6.1.42; BCAT1
UniProt IDF6T9A6
Protein RefseqThe length of the protein is386 amino acids long.
The sequence is show below: FKDCNNGCSAECTGETGSKEVVGTFKAKDLIITPATVLKEKPDPNTLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSMHPGTSAFHYAVELFEGFKAFRGVDNKIRLFRPKLNMDRMYRSAVRTTLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALIFVILSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKVGGNYGSSLFAQCEAMDNGCQQVLWLYGEDNQITEVGTMNLFLYWINEEGEEELATPPLDGIILPGVTRQSILDLAQKWGEFKVSERYLTMDDLTTALEENRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPKVASRILDKLTDIQYGREESNWTIIVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry