Mouse Anti-Horse BDNF Antibody (MO-AB-43848W)
Cat: MO-AB-43848W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Horse (Equus caballus) |
| Clone | MO43848W |
| Specificity | This antibody binds to Horse BDNF. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. |
| Product Overview | Mouse Anti-Horse BDNF Antibody is a mouse antibody against BDNF. It can be used for BDNF detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Bromodomain-containing nuclear protein 1; BDNF |
| UniProt ID | Q6X9Z4 |
| Protein Refseq | The length of the protein is31 amino acids long. The sequence is show below: GQNSMWISTDAAASVLEPLKVVWAKCSGYPS. |
See other products for " BDNF "
| MO-AB-29235W | Mouse Anti-Dog BDNF Antibody (MO-AB-29235W) |
| MO-DKB-03604W | Rabbit Anti-BDNF (AA 1-100, clone ms2109-012) Antibody (Cat MO-DKB-03604W) |
| CBMOAB-67619FYA | Mouse Anti-Zebrafish bdnf Antibody (CBMOAB-67619FYA) |
| MO-AB-41313W | Mouse Anti-Guinea pig BDNF Antibody (MO-AB-41313W) |
| CBMOAB-00274FYA | Rabbit Anti-Mouse BDNF Antibody (CBMOAB-00274FYA) |
| MO-NAB-00428W | Rabbit Anti-BDNF Antibody (C-terminal) |
| MOFY-0622-FY3 | Mouse Anti-BDNF Antibody (MOFY-0622-FY3) |
| MOFY-0622-FY118 | Rabbit Anti-BDNF Antibody (MOFY-0622-FY118) |
| MOFY-0622-FY209 | Rabbit Anti-BDNF Antibody (MOFY-0622-FY209) |
| CBMOAB-36905FYA | Mouse Anti-Rhesus BDNF Antibody (CBMOAB-36905FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry