Mouse Anti-Horse CD14 Antibody (MO-AB-43977W)


Cat: MO-AB-43977W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43977W
SpecificityThis antibody binds to Horse CD14.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD14 (CD14 Molecule) is a Protein Coding gene. Diseases associated with CD14 include Mycobacterium Chelonae and Croup. Among its related pathways are Bacterial infections in CF airways and Development Slit-Robo signaling. Gene Ontology (GO) annotations related to this gene include lipopolysaccharide binding and lipoteichoic acid binding.
Product OverviewMouse Anti-Horse CD14 (clone MO43977W) Antibody (MO-AB-43977W) is a mouse antibody against CD14. It can be used for CD14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLPS receptor; CD14
UniProt IDQ5XWB8
Protein RefseqThe length of the protein is357 amino acids long.
The sequence is show below: MVRAPCLLLLLPLLRFSAATLEPCEVDDENFRCVCNFTGPQPDWSSAFQCMTAVEVEIRGGGRNLEQFLKGASADPKQYADIVKALRLQRLTVGAVQVPAPLLVALLRALGYSRLKELTLEDLEVTGTMQPPPLEATGPPLSSLRLRNVSWATGGAWLAELQQWLKPGLKILSLAQAHSLAFSCAQLHSFSALHTLDLSDNPGLGERGLIAALCPHKFPALRDLALRNAGMQTPNGVCAAMAAAGVQPHSLDLSHNSLSAAAPGAPRCDWPSALSSLNLSFAGLEQVPKGLPGKLSVLDLSCNRLNKAPRADELPVVSNLILDRNPYLDPEASKQQDQNSGVVVACAHSALTVGISG.
For Research Use Only | Not For Clinical Use.

Online Inquiry