Mouse Anti-Horse CD14 Antibody (MO-AB-43979W)
Cat: MO-AB-43979W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Horse (Equus caballus) |
| Clone | MO43979W |
| Specificity | This antibody binds to Horse CD14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CD14 (CD14 Molecule) is a Protein Coding gene. Diseases associated with CD14 include Mycobacterium Chelonae and Croup. Among its related pathways are Bacterial infections in CF airways and Development Slit-Robo signaling. Gene Ontology (GO) annotations related to this gene include lipopolysaccharide binding and lipoteichoic acid binding. |
| Product Overview | Mouse Anti-Horse CD14 Antibody is a mouse antibody against CD14. It can be used for CD14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CD14 |
| UniProt ID | U3MJP0 |
| Protein Refseq | The length of the protein is71 amino acids long. The sequence is show below: DLSCNRLNKAPRADELPVVSNLILDRNPYLDPEASKQQDQNSGVVAACAHSALTVGISGTLALLRGAGDFA. |
See other products for " CD14 "
| CBMOAB-38622FYA | Mouse Anti-Rhesus CD14 Antibody (CBMOAB-38622FYA) |
| MO-AB-09769R | Mouse Anti-Cattle CD14 Antibody (MO-AB-09769R) |
| MOFY-0522-FY63 | Mouse Anti-CD14 Antibody (MOFY-0522-FY63) |
| CBMOAB-00022FYA | Mouse Anti-Cattle CD14 Antibody (CBMOAB-00022FYA) |
| MO-AB-14487Y | Mouse Anti-Sheep CD14 Antibody (MO-AB-14487Y) |
| MO-AB-34512W | Mouse Anti-Ferret CD14 Antibody (MO-AB-34512W) |
| MO-AB-07515Y | Mouse Anti-Rabbit CD14 Antibody (MO-AB-07515Y) |
| MO-AB-16680W | Mouse Anti-Chimpanzee CD14 Antibody (MO-AB-16680W) |
| MO-AB-01043Y | Mouse Anti-Chicken Cd14 Antibody (MO-AB-01043Y) |
| MOFY-0522-FY64 | Mouse Anti-CD14 Antibody (MOFY-0522-FY64) |
For Research Use Only | Not For Clinical Use.
Online Inquiry