Mouse Anti-Horse ITGAL Antibody (MO-AB-45196W)


Cat: MO-AB-45196W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO45196W
SpecificityThis antibody binds to Horse ITGAL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte function-associated antigen-1 (LFA-1), which is expressed on all leukocytes. LFA-1 plays a central role in leukocyte intercellular adhesion through interactions with its ligands, ICAMs 1-3 (intercellular adhesion molecules 1 through 3), and also functions in lymphocyte costimulatory signaling. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Horse ITGAL Antibody is a mouse antibody against ITGAL. It can be used for ITGAL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin alpha L chain; ITGAL
UniProt IDB5AZS0
Protein RefseqThe length of the protein is195 amino acids long.
The sequence is show below: QGAVYIFNGRHGGLSPEPSQRIEGTQVLSGIRWFGRSIHGVKDLGEDGLADVAVGAEGQVIMLSSRPVVDVITLLSFSPAEIPVHEVECSPSASNKKKEGVNITVCFQVKSLIPQFQGLLVANLTYTLQLDGHRTRSRGLFPGGRDKLSGNTAVTPVKSCTEFWFHFPVCIQDLISPINVSLNFSLWEEEGTPRD.
For Research Use Only | Not For Clinical Use.
Online Inquiry