Cat: MO-AB-45611W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Horse (Equus caballus) |
| Clone | MO45611W |
| Specificity | This antibody binds to Horse MYD88. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Horse MYD88 (clone MO45611W) Antibody (MO-AB-45611W) is a mouse antibody against MYD88. It can be used for MYD88 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Myeloid differentiation primary response 88; MYD88 |
| UniProt ID | Q4JIK1 |
| Protein Refseq | The length of the protein is49 amino acids long. The sequence is show below: CRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEF. |
See other products for " MYD88 "
| MO-AB-45612W | Mouse Anti-Horse MYD88 Antibody (MO-AB-45612W) |
| MO-AB-00943R | Mouse Anti-Medaka myd88 Antibody (MO-AB-00943R) |
| MO-AB-59597W | Mouse Anti-Marmoset MYD88 Antibody (MO-AB-59597W) |
| MO-AB-37733W | Mouse Anti-Goat myd88 Antibody (MO-AB-37733W) |
| MO-AB-33429H | Mouse Anti-Nile tilapia Myd88 Antibody (MO-AB-33429H) |
| CBMOAB-87971FYA | Mouse Anti-Zebrafish myd88 Antibody (CBMOAB-87971FYA) |
| MO-AB-35157W | Mouse Anti-Ferret MyD88 Antibody (MO-AB-35157W) |
| MO-AB-35158W | Mouse Anti-Ferret MYD88 Antibody (MO-AB-35158W) |
| MO-AB-42103W | Mouse Anti-Guinea pig Myd88 Antibody (MO-AB-42103W) |
| MO-AB-04536W | Mouse Anti-Rhesus MYD88 Antibody (MO-AB-04536W) |
For Research Use Only | Not For Clinical Use.