Mouse Anti-Horse SIRPA Antibody (MO-AB-46524W)
Cat: MO-AB-46524W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Horse (Equus caballus) |
| Clone | MO46524W |
| Specificity | This antibody binds to Horse SIRPA. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein can be phosphorylated by tyrosine kinases. The phospho-tyrosine residues of this PTP have been shown to recruit SH2 domain containing tyrosine phosphatases (PTP), and serve as substrates of PTPs. This protein was found to participate in signal transduction mediated by various growth factor receptors. CD47 has been demonstrated to be a ligand for this receptor protein. This gene and its product share very high similarity with several other members of the SIRP family. These related genes are located in close proximity to each other on chromosome 20p13. Multiple alternatively spliced transcript variants have been determined for this gene. |
| Product Overview | Mouse Anti-Horse SIRPA Antibody is a mouse antibody against SIRPA. It can be used for SIRPA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Signal regulatory protein alpha; SIRPA |
| UniProt ID | A8DS43 |
| Protein Refseq | The length of the protein is167 amino acids long. The sequence is show below: SHGFSPRNITLKWFKNGNELSASQTNVDPEENNVSYNISSTAQVVLAPGDVRSQVICEVAHITLQGAPPLRGTANLSETIRVPPTLEVSQHPTAENQENITCQANKFYPQQLKLTWLENGNVTRTETASTLIENKDGTFSWTSWLLVNSSARREDVVLTCQVEHDGQ. |
Reference
| Reference | Sebak, A., Hindy, A., Hassanein, S. I., & Gad, M. Z. (2021). 132P Tumor-responsive nanoparticles exhibit selective immunomodulatory effects: A Trojan horse strategy. Annals of Oncology, 32, S1434. |
See other products for " SIRPA "
| MOFY-0522-FY60 | Mouse Anti-SIRPA Antibody (MOFY-0522-FY60) |
| MO-AB-20142R | Mouse Anti-Cattle SIRPA Antibody (MO-AB-20142R) |
| MO-AB-64402W | Mouse Anti-Marmoset SIRPA Antibody (MO-AB-64402W) |
| CBMOAB-00025FYA | Mouse Anti-Cattle SIRPA Antibody (CBMOAB-00025FYA) |
| MO-AB-16442W | Mouse Anti-Chimpanzee SIRPA Antibody (MO-AB-16442W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry