Mouse Anti-HOXA13 Antibody (CBMOAB-44744FYA)


Cat: CBMOAB-44744FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44744FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Pig (Sus scrofa) WB, ELISA MO44744FYA 100 µg
MO-AB-02318Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02318Y 100 µg
MO-AB-04323H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04323C 100 µg
MO-AB-07531W Monoclonal Cat (Felis catus) WB, ELISA MO07531W 100 µg
MO-AB-26366R Monoclonal Pig (Sus scrofa) WB, ELISA MO26366R 100 µg
MO-AB-31142W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31142W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Pig (Sus scrofa)
CloneMO44744FYA
SpecificityThis antibody binds to Rhesus HOXA13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIn vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome.
Product OverviewMouse Anti-Rhesus HOXA13 Antibody is a mouse antibody against HOXA13. It can be used for HOXA13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHOXA13
UniProt IDF6YAG8
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: XGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry