Mouse Anti-hoxc13a Antibody (CBMOAB-79857FYA)


Cat: CBMOAB-79857FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79857FYA Monoclonal Zebrafish (Danio rerio), Medaka (Oryzias latipes) WB, ELISA MO79857FYA 100 µg
MO-AB-00703R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00703R 100 µg
MO-MMB-0607 Polyclonal Zebrafish (Danio rerio) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Medaka (Oryzias latipes)
CloneMO79857FYA
SpecificityThis antibody binds to Zebrafish hoxc13a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Product OverviewMouse Anti-Zebrafish hoxc13a Antibody is a mouse antibody against hoxc13a. It can be used for hoxc13a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein Hox-C13a; hoxc13
UniProt IDQ6JIY5
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: MTTSQVLHPRWADTLMYVYEKSPNENNQNKSQIMEGLSGNCPATHCRELISHPALGRHSGTIATHQGSVYSDISSPETGRQCPAPQTSSSASLSYGYPFGNPYYGCRLSHSHNVNLQQKPCSYHPAEKYAETSSALPTEELSSRAKEFAFYPSLASSYQAVPGYLDMSVVPSISVHPEPRHDALIPMEGYQHWALSNGWDGQVYCSKEQTQSSHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKIQLKELEKEYAASKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKFVSKSKTNNHMHT.
For Research Use Only | Not For Clinical Use.
Online Inquiry