Mouse Anti-Hspb8 Antibody (CBMOAB-20842FYA)
Cat: CBMOAB-20842FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-20842FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO20842FYA | 100 µg | ||
| CBMOAB-80110FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80110FYA | 100 µg | ||
| MO-AB-04402H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04402C | 100 µg | ||
| MO-AB-11395W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11395W | 100 µg | ||
| MO-AB-13885R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13885R | 100 µg | ||
| MO-AB-26395H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26395C | 100 µg | ||
| MO-AB-31190W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31190W | 100 µg | ||
| MO-AB-34909W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34909W | 100 µg | ||
| MO-AB-57035W | Monoclonal | Marmoset | WB, ELISA | MO57035W | 100 µg | ||
| MO-DKB-01097W | Polyclonal | Human (Homo sapiens), Dog (Canis lupus familiaris), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO20842FYA |
| Specificity | This antibody binds to fruit fly Hspb8. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. |
| Product Overview | Mouse Anti-D. melanogaster Hspb8 Antibody is a mouse antibody against Hspb8. It can be used for Hspb8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CG14207-PB, isoform B; RE23625p; RE52196p; HspB8; CG14207-RB |
| UniProt ID | Q8IQW5 |
| Protein Refseq | The length of the protein is 192 amino acids long. The sequence is show below: MAEANKRNIPIKLGDFSVIDTEFSNIRERFDSEMRKMEEEMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALPSRIPKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLIPIAHK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry