Mouse Anti-HTR1D Antibody (CBMOAB-44928FYA)


Cat: CBMOAB-44928FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44928FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO44928FYA 100 µg
CBMOAB-80145FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80145FYA 100 µg
MO-AB-08418Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08418Y 100 µg
MO-AB-26417R Monoclonal Pig (Sus scrofa) WB, ELISA MO26417R 100 µg
MO-AB-31196W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31196W 100 µg
MO-AB-41828W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41828W 100 µg
MO-AB-57044W Monoclonal Marmoset WB, ELISA MO57044W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO44928FYA
SpecificityThis antibody binds to Rhesus HTR1D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHTR1D (5-Hydroxytryptamine Receptor 1D) is a Protein Coding gene. Diseases associated with HTR1D include Migraine With Or Without Aura 1 and Major Depressive Disorder. Among its related pathways are Monoamine GPCRs and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1B.
Product OverviewMouse Anti-Rhesus HTR1D Antibody is a mouse antibody against HTR1D. It can be used for HTR1D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHTR1D
UniProt IDQ8MJA4
Protein RefseqThe length of the protein is 102 amino acids long.
The sequence is show below: ANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry