Mouse Anti-IL17D Antibody (CBMOAB-45266FYA)


Cat: CBMOAB-45266FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45266FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45266FYA 100 µg
CBMOAB-80629FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80629FYA 100 µg
MO-AB-02468Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02468Y 100 µg
MO-AB-11816Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11816Y 100 µg
MO-AB-26484H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26484C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45266FYA
SpecificityThis antibody binds to Rhesus IL17D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent. (From NCBI)
Product OverviewMouse Anti-Rhesus IL17D Antibody is a mouse antibody against IL17D. It can be used for IL17D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-17D; IL17D
UniProt IDH9F619
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: LLEQLYGRLAARVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKPGAKLLLGPNDAPAGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry