AibGenesis™ Mouse Anti-KHDC3L Antibody (CBMOAB-46068FYA)


Cat: CBMOAB-46068FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46068FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO46068FYA 100 µg
MO-AB-14637W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14637W 100 µg
MO-AB-57756W Monoclonal Marmoset WB, ELISA MO57756W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO46068FYA
SpecificityThis antibody binds to Rhesus KHDC3L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the KHDC1 family, members of which contain an atypical KH domain that may not bind RNA like canonical KH domains. This gene is specifically expressed in the oocytes, and recent studies suggest that it may function as a regulator of genomic imprinting in the oocyte. Mutations in this gene are associated with recurrent biparental complete hydatidiform mole. (From NCBI)
Product OverviewMouse Anti-Rhesus KHDC3L Antibody is a mouse antibody against KHDC3L. It can be used for KHDC3L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKHDC3L
UniProt IDF6SZT2
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MDTPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRDRERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATKKAEIQLSSTEVREAGTQRSVEVREVGTQGSPVEVRETGTQQSLEAANQSGTQRSPEAANKAVTQRFREDTRAPVTRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry