AibGenesis™ Mouse Anti-LEMD1 Antibody (CBMOAB-46851FYA)


Cat: CBMOAB-46851FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46851FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO46851FYA 100 µg
MO-AB-14862R Monoclonal Cattle (Bos taurus) WB, ELISA MO14862R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO46851FYA
SpecificityThis antibody binds to Rhesus LEMD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LEMD1 Antibody is a mouse antibody against LEMD1. It can be used for LEMD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLEMD1
UniProt IDF6Z646
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDSEELNIILQGNIILSTEKSKKLKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry