Mouse Anti-Maize ada2 Antibody (MO-AB-47204W)


Cat: MO-AB-47204W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays)
CloneMO47204W
SpecificityThis antibody binds to Maize ada2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Maize ada2 Antibody is a mouse antibody against ada2. It can be used for ada2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscriptional adaptor; ada2
UniProt IDQ8S9F8
Protein RefseqThe length of the protein is565 amino acids long.
The sequence is show below: MGRSRGVQNSGDDDTVHRSKRRRVASGGDATDSVSAGIGGAGEGGGKKALYHCNYCNKDISGKIRIKCSKCPDFDLCVECFSVGAEVTPHRSNHPYKVMDNLSFPLICPDWNADEEILLLEGIEMYGLGNWLEVAEHVGTKSKLQCIDHYTTAYMNSPCYPLPDMSHVNGKNRKELLAMAKVQGESKKGTSLLPGELTPKAESPFSPSRVKVEDALGEGLAGRSPSHIAVGANKKASNVGHIKDGSNVSKVEDGHVDRSVGVKKPRYSADEGPSLTELSGYNAKRHEFDPEYDNDAEQALAEMEFKETDSETDRELKLRVLRIYLSRLDERKRRKEFILERNLLFPNPLEKDLTNEDREVYHRYKVFMRFLSKEEHEALVRSVIEERKIRRRIQELQECRSAGCRTLAEAKIHIEQKRKKEYELNAQKAKESNHLIANTKLVQKMNRPMKIESDGNLDPKKGGVALDSPKTTGLTSVKQWDDWDIVGLPGAKLLSASEKLLCCQNRLLPSHYLRMQEVLMQEIFKGSVLKKEDAHVLFKVDPTKVDSVYDMVTKKLGNHVELPTV.
For Research Use Only | Not For Clinical Use.
Online Inquiry