Mouse Anti-Malaria parasite AroC Antibody (MO-AB-11015H)


Cat: MO-AB-11015H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMalaria parasite
CloneMO11015C
SpecificityThis antibody binds to Malaria parasite AroC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. It uses NADPH to reduce FMN.
Product OverviewThis product is a mouse antibody against AroC. It can be used for AroC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChorismate synthase; AroC
UniProt IDO15864
Protein RefseqThe length of the protein is 527 amino acids long.
The sequence is show below: MSTYGTLLKVTSYGESHGKAIGCVIDGFLSNIEINFDLIQKQLDRRRPNQSKLTSNRNEKDKLVILSGFDENKTLGTPITFLIYNEDIKKEDYNSFINIPRPGHGDYTYFMKYHVKNKSGSSRFSGRETATRVAAGACIEQWLYKSYNCSIVSYVHSVGNIKIPEQVSKELENKNPPSRDLVDSYGTVRYNEKEKIFMDCFNRIYDMNASMLKTDEYNKNTLTIPSIDNTYINVKTNECNINQVDNNHNNYINDKDNTFNNSEKSDEWIYLQTRCPHPYTAVQICSYILKLKNKGDSVGGIATCIIQNPPIGIGEPIFDKLEAELAKMILSIPPVKGIEFGSGFNGTYMFGSMHNDIFIPVENMSTKKESDLLYDDKGECKNMSYHSTIQNNEDQILNSTKGFMPPKNDKNFNNIDDYNVTFNNNEEKLLITKTNNCGGILAGISTGNNIVFRSAIKPVSSIQIEKETSDFYGNMCNLKVQGRHDSCILPRLPPIIEASSSMVIGDLILRQISKYGDKKLPTLFRNM.
See other products for " aroC "
For Research Use Only | Not For Clinical Use.
Online Inquiry