Mouse Anti-Mallard AARS Antibody (MO-AB-22803H)


Cat: MO-AB-22803H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos)
CloneMO22803C
SpecificityThis antibody binds to Mallard AARS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.
Product OverviewThis product is a mouse antibody against AARS. It can be used for AARS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlanine--tRNA ligase, cytoplasmic; EC 6.1.1.7; Alanyl-tRNA synthetase; AARS
UniProt IDU3ILW3
Protein RefseqThe length of the protein is 916 amino acids long.
The sequence is show below: MESTLTASQIRQRFIDFFKENQHTYVHSSSTIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPLAKLSRATNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKLALDLLTKEFGIPAERLYVTYFGGNEAAGLQPDLECKQIWLNLGLPEGRILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGDRDASHLVNQDDPNVLEIWNLVFIQFNREADGTLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFLPYFEAIQKGTGARPYMGQVGAEDADGIDMAYRVLADHARTITLSDGGRPDNTGRGYVLRRILRRAVRYSHEKLNAPKGFFATLVDVVVQSLGDAFPELKKDPDMVKDIINEEEDQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGFPVDLTGLIAEEKGLVVDMEGFEEERKNAQLKSQGKGAGGEDLLMLDIYAIEELRAQGLEVTDDSPKYSYTSDPSGTYDFGSLVATVKAIRREKKFVEEVSTGQECGIVLDRTCFYAEQGGQIYDQGYMVKDDDSREDRRRGQASSRGFLSVAGVGICTGFLFRGAAQHRCAGVGSYCFLGSCAELCCSIRLSPGVPSTRVCWLESLRDSWLGLCQHSTKRDGGGREVWASGRRGLVRELLSSFWEDFGIFSGEESGQHHTLALDGSATSLGVTELHAWGCSLPDPSHGDGQEALRKVDSLKKLLSALDAKVKVQTAPNKDVQKEITDLSETLATAVIPQWQKDELREAVKALKKVMDDLDRASKADIQKRVLEKTKQVIESHPNQPLVIMEMENGASAKALNESLKLFKTHSPQTATMLFAVDNEAGRITCLCQVPQETXKKGLKASQWVQEVSGLMDGKGGGKDVSAQATGKNVGCLPEALRLATDFARLHLGELKN.
For Research Use Only | Not For Clinical Use.
Online Inquiry