Mouse Anti-Mallard DPM1 Antibody (MO-AB-23151H)


Cat: MO-AB-23151H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos)
CloneMO23151C
SpecificityThis antibody binds to Mallard DPM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. Human DPM1 lacks a carboxy-terminal transmembrane domain and signal sequence and is regulated by DPM2. Mutations in this gene are associated with congenital disorder of glycosylation type Ie. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against DPM1. It can be used for DPM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMHC class II antigen; DRA
UniProt IDU3IIQ9
Protein RefseqThe length of the protein is 141 amino acids long.
The sequence is show below: FDFDGDEIFHVDLEKSETIWRLPIFTTFTSFEAQGALQNIAVDKQNMEIMMKRSNRSQGTIAPPEVTVFSEDPVELGDPNILICYVDKFWPSVITITWMKNGQEVTEGISETVFYRQADNGFYKFSYLPFIPTRGDYYDCRVEHWGLREPLMTHWEPQVPLPVSESTETLVCALGLAVGIVGIVVGTILIIKAMKMNNARNQRGLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry