Cat: MO-AB-23186H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Mallard (Anas platyrhynchos) |
Clone | MO23186C |
Specificity | This antibody binds to Mallard ENO1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. |
Product Overview | This product is a mouse antibody against ENO1. It can be used for ENO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alpha-enolase; ENO1 |
UniProt ID | T2B0V2 |
Protein Refseq | The length of the protein is 39 amino acids long. The sequence is show below: DFKSPDDPXRYISPDQLADLYKGFVKNYPVVSIEDPFDQ. |
See other products for " ENO1 "
MO-NAB-00212W | Mouse Anti-Rhesus ENO1 Antibody (MO-NAB-00212W) |
CBMOAB-41778FYA | Mouse Anti-Rhesus ENO1 Antibody (CBMOAB-41778FYA) |
MO-MMB-0313 | Rabbit Anti-ENO1 Antibody (Cat MO-MMB-0313) |
CBMOAB-22621FYB | Mouse Anti-Rice ENO1 Antibody (CBMOAB-22621FYB) |
CBMOAB-41779FYA | Mouse Anti-Rhesus ENO1 Antibody (CBMOAB-41779FYA) |
CBMOAB-28433FYC | Mouse Anti-Arabidopsis ENO1 Antibody (CBMOAB-28433FYC) |
MO-DKB-00690W | Rabbit Anti-ENO1 Antibody (MO-DKB-00690W) |
MO-AB-23187H | Mouse Anti-Mallard ENO1 Antibody (MO-AB-23187H) |
CBMOAB-59826FYC | Mouse Anti-Rhesus ENO1 Antibody (CBMOAB-59826FYC) |
MO-AB-01754Y | Mouse Anti-Chicken ENO1 Antibody (MO-AB-01754Y) |
For Research Use Only | Not For Clinical Use.