Mouse Anti-Marmoset ALG13 Antibody (MO-AB-50732W)


Cat: MO-AB-50732W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO50732W
SpecificityThis antibody binds to Marmoset ALG13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizes with asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes the second sugar addition of the highly conserved oligosaccharide precursor in endoplasmic reticulum N-linked glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Marmoset ALG13 Antibody is a mouse antibody against ALG13. It can be used for ALG13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUDP-N-acetylglucosamine transferase subunit ALG13 homolog isoform 2; ALG13
UniProt IDU3FXV1
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MKCLFVTVGTTSFDDLIACVSAPDSLQKIESLGYSRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLLVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVELQK.
For Research Use Only | Not For Clinical Use.
Online Inquiry