Mouse Anti-Marmoset BRCA1 Antibody (MO-AB-51933W)


Cat: MO-AB-51933W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO51933W
SpecificityThis antibody binds to Marmoset BRCA1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified.
Product OverviewMouse Anti-Marmoset BRCA1 (clone MO51933W) Antibody (MO-AB-51933W) is a mouse antibody against BRCA1. It can be used for BRCA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBreast and ovarian cancer susceptibility 1; BRCA1
UniProt IDG5CWM0
Protein RefseqThe length of the protein is 943 amino acids long.
The sequence is show below: PCGTNTHASSLWHENSSLLLTKDRLNVEKAEFCNKSKQPGLARSQHNRWAESEETCNDRQTPSTEKKVDLDADPLHGRKEWNEQKPPCSEKPRDDTEDVAWLTLNSSIQKVNEWFSRSDELLTSDDSHDEGSESNAKVAEALEVLNEVDGYSSSSEKIDLLASDPHDALICKSERVHCKSVESSIEDKIFGKTYRRKASLPNLSHVTENLIIGAFVTEPQITQEHPLTNKLKRKRRVTSGLHPEDFIKKADLAVQKTPEKINQGTNQMERNDQVMNITNSGHENKTKGDSIQNENNPNPVESLEKESFRSKAEPISSSISNMELELNIHNSKASKKNRLRRKSSTRHIHELELVVSRNLSPPNYTEVQIDSCSSSEELKKKNYNQMPVRHSRKLQLMEDKERSTGAKKSSKSNEQSKRHASDTFPELRLTNIPDSFTNCSNTNELKEFVNPSLPREEKEKLETVKLSNDAKDPNDLMLSGESVLQIERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKELIHGGSKDTRNGTEGFKYPLGPEVNYSQETSIDMEESELDTQYLQNTFKVSKRQSFALFSNPGNPEKECATFSAHSGPLKKQSPKVTLECEQKEENQGEKESNSEPVETVNITAGFPMVCQKDKPVDYAKGIEGGSGLCLSSQFRGNETGLIIPNKHGLLQNPYHIPPLIPTRSFVKTKYKKNLLEENSEEHSMSPERAMGNKNIIPSTVSTISHNNRENAFKETSSSSINEVGSSTNEVGSSINEVGSSDENIQAETXRNRXPRLNAMLRLQLLQPEMYXRSLPISNCKHPDTKKPEHEVVQTVNTDLSPCLISDNVKQHMGSSHTCQVCSETPEDLLDDGEIKEDTSFAEYGIKETSAVFSKSVQRGELSRSPSPFTHTHLAQVYQRGAKKLESSEENLSSE.

See other products for " BRCA1 "

CBMOAB-37077FYAMouse Anti-Rhesus BRCA1 Antibody (CBMOAB-37077FYA)
CBMOAB-37083FYAMouse Anti-Rhesus BRCA1 Antibody (CBMOAB-37083FYA)
MO-AB-15019WMouse Anti-Chimpanzee BRCA1 Antibody (MO-AB-15019W)
MO-AB-09116RMouse Anti-Cattle BRCA1 Antibody (MO-AB-09116R)
MO-AB-15022WMouse Anti-Chimpanzee BRCA1 Antibody (MO-AB-15022W)
CBMOAB-37079FYAMouse Anti-Rhesus BRCA1 Antibody (CBMOAB-37079FYA)
MO-AB-07366YMouse Anti-Rabbit BRCA1 Antibody (MO-AB-07366Y)
MO-AB-00898YMouse Anti-Chicken BRCA1 Antibody (MO-AB-00898Y)
MO-AB-01320WMouse Anti-Rhesus BRCA1 Antibody (MO-AB-01320W)
MO-AB-15023WMouse Anti-Chimpanzee BRCA1 Antibody (MO-AB-15023W)
For Research Use Only | Not For Clinical Use.

Online Inquiry