Mouse Anti-Marmoset BRCA1 Antibody (MO-AB-51933W)
Cat: MO-AB-51933W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Marmoset |
Clone | MO51933W |
Specificity | This antibody binds to Marmoset BRCA1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified. |
Product Overview | Mouse Anti-Marmoset BRCA1 Antibody is a mouse antibody against BRCA1. It can be used for BRCA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Breast and ovarian cancer susceptibility 1; BRCA1 |
UniProt ID | G5CWM0 |
Protein Refseq | The length of the protein is 943 amino acids long. The sequence is show below: PCGTNTHASSLWHENSSLLLTKDRLNVEKAEFCNKSKQPGLARSQHNRWAESEETCNDRQTPSTEKKVDLDADPLHGRKEWNEQKPPCSEKPRDDTEDVAWLTLNSSIQKVNEWFSRSDELLTSDDSHDEGSESNAKVAEALEVLNEVDGYSSSSEKIDLLASDPHDALICKSERVHCKSVESSIEDKIFGKTYRRKASLPNLSHVTENLIIGAFVTEPQITQEHPLTNKLKRKRRVTSGLHPEDFIKKADLAVQKTPEKINQGTNQMERNDQVMNITNSGHENKTKGDSIQNENNPNPVESLEKESFRSKAEPISSSISNMELELNIHNSKASKKNRLRRKSSTRHIHELELVVSRNLSPPNYTEVQIDSCSSSEELKKKNYNQMPVRHSRKLQLMEDKERSTGAKKSSKSNEQSKRHASDTFPELRLTNIPDSFTNCSNTNELKEFVNPSLPREEKEKLETVKLSNDAKDPNDLMLSGESVLQIERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKELIHGGSKDTRNGTEGFKYPLGPEVNYSQETSIDMEESELDTQYLQNTFKVSKRQSFALFSNPGNPEKECATFSAHSGPLKKQSPKVTLECEQKEENQGEKESNSEPVETVNITAGFPMVCQKDKPVDYAKGIEGGSGLCLSSQFRGNETGLIIPNKHGLLQNPYHIPPLIPTRSFVKTKYKKNLLEENSEEHSMSPERAMGNKNIIPSTVSTISHNNRENAFKETSSSSINEVGSSTNEVGSSINEVGSSDENIQAETXRNRXPRLNAMLRLQLLQPEMYXRSLPISNCKHPDTKKPEHEVVQTVNTDLSPCLISDNVKQHMGSSHTCQVCSETPEDLLDDGEIKEDTSFAEYGIKETSAVFSKSVQRGELSRSPSPFTHTHLAQVYQRGAKKLESSEENLSSE. |
See other products for " BRCA1 "
MO-AB-29265W | Mouse Anti-Dog BRCA1 Antibody (MO-AB-29265W) |
MO-AB-42966W | Mouse Anti-Hamsters BRCA1 Antibody (MO-AB-42966W) |
MO-AB-09116R | Mouse Anti-Cattle BRCA1 Antibody (MO-AB-09116R) |
MO-AB-34168W | Mouse Anti-Donkey BRCA1 Antibody (MO-AB-34168W) |
MO-AB-15024W | Mouse Anti-Chimpanzee BRCA1 Antibody (MO-AB-15024W) |
MO-AB-01319W | Mouse Anti-Rhesus BRCA1 Antibody (MO-AB-01319W) |
MO-AB-30602H | Mouse Anti-Purple sea urchin brca1 Antibody (MO-AB-30602H) |
MO-AB-00898Y | Mouse Anti-Chicken BRCA1 Antibody (MO-AB-00898Y) |
MO-AB-14401Y | Mouse Anti-Sheep BRCA1 Antibody (MO-AB-14401Y) |
MO-AB-01921H | Mouse Anti-Frog brca1 Antibody (MO-AB-01921H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry