Cat: MO-AB-57402W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Marmoset |
Clone | MO57402W |
Specificity | This antibody binds to Marmoset ITGA4. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 4 subunit. This subunit associates with a beta 1 or beta 7 subunit to form an integrin that may play a role in cell motility and migration. This integrin is a therapeutic target for the treatment of multiple sclerosis, Crohn's disease and inflammatory bowel disease. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Marmoset ITGA4 (clone MO57402W) Antibody (MO-AB-57402W) is a mouse antibody against ITGA4. It can be used for ITGA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Integrin alpha 4; ITGA4 |
UniProt ID | I3W9H5 |
Protein Refseq | The length of the protein is 66 amino acids long. The sequence is show below: DHVKKFGEHFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNMTTNIYKAFLDGQNQVKFGSYL. |
See other products for " ITGA4 "
CBMOAB-45625FYA | Mouse Anti-Rhesus ITGA4 Antibody (CBMOAB-45625FYA) |
MO-AB-57401W | Mouse Anti-Marmoset ITGA4 Antibody (MO-AB-57401W) |
CBMOAB-81235FYA | Mouse Anti-Zebrafish itga4 Antibody (CBMOAB-81235FYA) |
MO-AB-11907Y | Mouse Anti-O. mykiss Itga4 Antibody (MO-AB-11907Y) |
CBMOAB-45626FYA | Mouse Anti-Rhesus ITGA4 Antibody (CBMOAB-45626FYA) |
MO-AB-57400W | Mouse Anti-Marmoset ITGA4 Antibody (MO-AB-57400W) |
MO-AB-26737R | Mouse Anti-Pig ITGA4 Antibody (MO-AB-26737R) |
CBMOAB-81234FYA | Mouse Anti-Zebrafish itga4 Antibody (CBMOAB-81234FYA) |
CBMOAB-00043FYA | Mouse Anti-Cattle ITGA4 Antibody (CBMOAB-00043FYA) |
MO-AB-14320R | Mouse Anti-Cattle ITGA4 Antibody (MO-AB-14320R) |
For Research Use Only | Not For Clinical Use.