Mouse Anti-Marmoset MOCS2 Antibody (MO-AB-59218W)


Cat: MO-AB-59218W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO59218W
SpecificityThis antibody binds to Marmoset MOCS2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits.
Product OverviewMouse Anti-Marmoset MOCS2 Antibody is a mouse antibody against MOCS2. It can be used for MOCS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMolybdopterin synthase catalytic subunit; EC 2.8.1.12; Molybdenum cofactor synthesis protein 2 large subunit; Molybdenum cofactor synthesis protein 2B; MOCS2
UniProt IDU3ECX2
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: MSSLEISSSCFNQETKLLLSPPLAEGSAFEPYRGDMDEVEEKSKDIINFTAEKLSVDEISKLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICGDIRQKWPVKHIAVFHRLGLVPVSEASIIIAISSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSSWKRNKECFWASNN.
For Research Use Only | Not For Clinical Use.
Online Inquiry