Mouse Anti-Marmoset TP53 Antibody (MO-AB-66716W)


Cat: MO-AB-66716W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO66716W
SpecificityThis antibody binds to Marmoset TP53.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277).
Product OverviewMouse Anti-Marmoset TP53 Antibody is a mouse antibody against TP53. It can be used for TP53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCellular tumor antigen p53; TP53
UniProt IDU3D146
Protein RefseqThe length of the protein is 395 amino acids long.
The sequence is show below: MEEPQSDLSIEPPLSQETFSDLWKLLPENNILSSSLSQPVDDLMLSPDDIDIAQWLSQDPVPDEAPTVSEAPPAMAQAPAAPTLVAPTPAPSWPLSSSVPSQKTYHGDYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPRGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLHVEYLDDKNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCLDLPPGSTKRAMPNSTSSSPQPKKKPLDGEYFTLQIHGRERFEMFRELNEALELKDAQAGKEPGGSRAHSNHLKSKKGQCTPRHKKLMVKREGPDSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry