AibGenesis™ Mouse Anti-MATK Antibody (CBMOAB-36245FYC)
Cat: CBMOAB-36245FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36245FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cattle (Bos taurus), Cottonwood (Populus deltoids), Cucumber (Cucumis sativus), French-bean, Grape (Vitis vinifera), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Sugar beet (Beta vulgaris), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) | WB, ELISA | MO36245FC | 100 µg | ||
| CBMOAB-50917FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO50917FYA | 100 µg | ||
| CBMOAB-86095FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO86095FYA | 100 µg | ||
| CBMOAB-34612FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO34612FYB | 100 µg | ||
| MO-AB-00306W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00306W | 100 µg | ||
| MO-AB-04301W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04301W | 100 µg | ||
| MO-AB-27797W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27797W | 100 µg | ||
| MO-AB-28514W | Monoclonal | Cucumber (Cucumis sativus) | WB, ELISA | MO28514W | 100 µg | ||
| MO-AB-36279W | Monoclonal | French-bean | WB, ELISA | MO36279W | 100 µg | ||
| MO-AB-39207W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39207W | 100 µg | ||
| MO-AB-58784W | Monoclonal | Marmoset | WB, ELISA | MO58784W | 100 µg | ||
| MO-AB-15395R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15395R | 100 µg | ||
| MO-AB-00672H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00672C | 100 µg | ||
| MO-AB-30290H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30290C | 100 µg | ||
| MO-AB-34870H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34870C | 100 µg | ||
| MO-AB-01879L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01879L | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cattle (Bos taurus), Cottonwood (Populus deltoids), Cucumber (Cucumis sativus), French-bean, Grape (Vitis vinifera), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Sugar beet (Beta vulgaris), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) |
| Clone | MO36245FC |
| Specificity | This antibody binds to Arabidopsis MATK. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis MATK Antibody is a mouse antibody against MATK. It can be used for MATK detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Megakaryocyte-Associated Tyrosine Kinase; Hematopoietic Consensus Tyrosine-Lacking Kinase; Tyrosine-Protein Kinase CTK; Protein Kinase HYL; Leukocyte Carboxyl-Terminal Src Kinase Related; Csk-Type Protein Tyrosine Kinase; Hydroxyaryl-Protein Kinase; Tyrosylprotein Kinase; Csk-Homologous Kinase; CSK Homologous Kinase; Tyrosine Kinase MATK |
| UniProt ID | P56784 |
| Protein Refseq | The length of the protein is 504 amino acids long. The sequence is show below: MDKFQGYLEFDGARQQSFLYPLFFREYIYVLAYDHGLNRLNRNRYIFLENADYDKKYSSLITKRLILRMYEQNRLIIPTKDVNQNSFLGHTSLFYYQMISVLFAVIVEIPFSLRLGSSFQGKQLKKSYNLQSIHSIFPFLEDKLGHFNYVLDVLIPYPIHLEILVQTLRYRVKDASSLHFFRFCLYEYCNWKNFYIKKKSILNPRFFLFLYNSHVCEYESIFFFLRKRSSHLRSTSYEVLFERIVFYGKIHHFFKVFVNNFPAILGLLKDPFIHYVRYHGRCILATKDTPLLMNKWKYYFVNLWQCYFSVWFQSQKVNINQLSKDNLEFLGYLSSLRLNPLVVRSQMLENSFLIDNVRIKLDSKIPISSIIGSLAKDKFCNVLGHPISKATWTDSSDSDILNRFVRICRNISHYYSGSSKKKNLYRIKYILRLCCVKTLARKHKSTVRTFLKRLGSGLLEEFLTGEDQVLSLIFPRSYYASKRLYRVRIWYLDILYLNDLVNHE. |
See other products for " matK "
For Research Use Only | Not For Clinical Use.
Online Inquiry