Mouse Anti-MATK Antibody (CBMOAB-36245FYC)
Cat: CBMOAB-36245FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36245FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cattle (Bos taurus), Cottonwood (Populus deltoids), Cucumber (Cucumis sativus), French-bean, Grape (Vitis vinifera), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Sugar beet (Beta vulgaris), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) | WB, ELISA | MO36245FC | 100 µg | ||
| CBMOAB-50917FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO50917FYA | 100 µg | ||
| CBMOAB-86095FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO86095FYA | 100 µg | ||
| CBMOAB-34612FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO34612FYB | 100 µg | ||
| MO-AB-00306W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00306W | 100 µg | ||
| MO-AB-04301W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04301W | 100 µg | ||
| MO-AB-27797W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27797W | 100 µg | ||
| MO-AB-28514W | Monoclonal | Cucumber (Cucumis sativus) | WB, ELISA | MO28514W | 100 µg | ||
| MO-AB-36279W | Monoclonal | French-bean | WB, ELISA | MO36279W | 100 µg | ||
| MO-AB-39207W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39207W | 100 µg | ||
| MO-AB-58784W | Monoclonal | Marmoset | WB, ELISA | MO58784W | 100 µg | ||
| MO-AB-15395R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15395R | 100 µg | ||
| MO-AB-00672H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00672C | 100 µg | ||
| MO-AB-30290H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30290C | 100 µg | ||
| MO-AB-34870H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34870C | 100 µg | ||
| MO-AB-01879L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01879L | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cattle (Bos taurus), Cottonwood (Populus deltoids), Cucumber (Cucumis sativus), French-bean, Grape (Vitis vinifera), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Sugar beet (Beta vulgaris), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) |
| Clone | MO36245FC |
| Specificity | This antibody binds to Arabidopsis MATK. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. |
| Product Overview | Mouse Anti-Arabidopsis MATK Antibody is a mouse antibody against MATK. It can be used for MATK detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Megakaryocyte-Associated Tyrosine Kinase; Hematopoietic Consensus Tyrosine-Lacking Kinase; Tyrosine-Protein Kinase CTK; Protein Kinase HYL; Leukocyte Carboxyl-Terminal Src Kinase Related; Csk-Type Protein Tyrosine Kinase; Hydroxyaryl-Protein Kinase; Tyrosylprotein Kinase; Csk-Homologous Kinase; CSK Homologous Kinase; Tyrosine Kinase MATK |
| UniProt ID | P56784 |
| Protein Refseq | The length of the protein is 504 amino acids long. The sequence is show below: MDKFQGYLEFDGARQQSFLYPLFFREYIYVLAYDHGLNRLNRNRYIFLENADYDKKYSSLITKRLILRMYEQNRLIIPTKDVNQNSFLGHTSLFYYQMISVLFAVIVEIPFSLRLGSSFQGKQLKKSYNLQSIHSIFPFLEDKLGHFNYVLDVLIPYPIHLEILVQTLRYRVKDASSLHFFRFCLYEYCNWKNFYIKKKSILNPRFFLFLYNSHVCEYESIFFFLRKRSSHLRSTSYEVLFERIVFYGKIHHFFKVFVNNFPAILGLLKDPFIHYVRYHGRCILATKDTPLLMNKWKYYFVNLWQCYFSVWFQSQKVNINQLSKDNLEFLGYLSSLRLNPLVVRSQMLENSFLIDNVRIKLDSKIPISSIIGSLAKDKFCNVLGHPISKATWTDSSDSDILNRFVRICRNISHYYSGSSKKKNLYRIKYILRLCCVKTLARKHKSTVRTFLKRLGSGLLEEFLTGEDQVLSLIFPRSYYASKRLYRVRIWYLDILYLNDLVNHE. |
See other products for " matK "
| MO-AB-31874H | Mouse Anti-matK Antibody (MO-AB-31874H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry