AibGenesis™ Mouse Anti-MBOAT7 Antibody (CBMOAB-50961FYA)


Cat: CBMOAB-50961FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-50961FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO50961FYA 100 µg
CBMOAB-86211FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86211FYA 100 µg
MO-AB-04323W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04323W 100 µg
MO-AB-08771Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08771Y 100 µg
MO-AB-15414R Monoclonal Cattle (Bos taurus) WB, ELISA MO15414R 100 µg
MO-AB-24316W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24316W 100 µg
MO-AB-58826W Monoclonal Marmoset WB, ELISA MO58826W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO50961FYA
SpecificityThis antibody binds to Rhesus MBOAT7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the membrane-bound O-acyltransferases family of integral membrane proteins that have acyltransferase activity. The encoded protein is a lysophosphatidylinositol acyltransferase that has specificity for arachidonoyl-CoA as an acyl donor. This protein is involved in the reacylation of phospholipids as part of the phospholipid remodeling pathway known as the Land cycle. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus MBOAT7 Antibody is a mouse antibody against MBOAT7. It can be used for MBOAT7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMBOAT7
UniProt IDF7CX36
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: LSPEEWTYLVVLLISIPIGFLFKKAGPGLKRWGAAAVGLGLTLFTCGPHTLHSLITILGTWALIQAQPCSCHALALAWTFSYLLFFRALSLLGLPTPTPFTNAVQLLLTLKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry