Mouse Anti-MED28 Antibody (MO-AB-58939W)


Cat: MO-AB-58939W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-58939W Monoclonal Marmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO58939W 100 µg
CBMOAB-23587FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO23587FYA 100 µg
MO-AB-04371W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04371W 100 µg
MO-AB-10901W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10901W 100 µg
MO-AB-15527R Monoclonal Cattle (Bos taurus) WB, ELISA MO15527R 100 µg
MO-AB-27038H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27038C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO58939W
SpecificityThis antibody binds to Marmoset MED28.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Marmoset MED28 Antibody is a mouse antibody against MED28. It can be used for MED28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 28; MED28
UniProt IDU3FPB1
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MAAPLGGMFSGQPPGPPQPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVSGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQQKDAPVQKHLTKLRHRQQVLEDISAQHKKPADIPQGSLAYLEQASANIPAPLKPT.
For Research Use Only | Not For Clinical Use.
Online Inquiry