Mouse Anti-Medaka alad Antibody (MO-AB-00039R)


Cat: MO-AB-00039R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00039R
SpecificityThis antibody binds to Medaka alad.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Product OverviewThis product is a mouse antibody against alad. It can be used for alad detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDelta-aminolevulinic acid dehydratase; EC 4.2.1.24; LOC101162461
UniProt IDH2MF62
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MQTPAQSVLHSGYFHQTLRFWQTCATNLRPENLIYPIFVTDAADAVEPINSLPGQARYGVNKLEEMLKPLVAKGLKCVLIFGVPAKIAKDDRGSGADTDDTPAVLAVKKIRSLFPELLVSCDVCLCPYTSHGHCGILNDDGTLNNDASCLRLAEVALAYARAGCHIIAPSDMMDGRVGAIKQALLSNGLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRAVERDVREGADMLMVKPGLPYLDILREVKDKFPTHPLAVYNVSGEFAMMWHGAKAGAFDLRAAVMEAMTAFRRAGADIIITYFTPELLSWLNES.
For Research Use Only | Not For Clinical Use.

Online Inquiry