Mouse Anti-Medaka IL-17A Antibody (MO-AB-00750R)


Cat: MO-AB-00750R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00750R
SpecificityThis antibody binds to Medaka IL-17A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIL-17A (IL-17A, IL17A) is a potent pro-inflammatory cytokine produced by activated Th17 (T helper 17) cells and certain cells belonging to the innate immune system. In mice, IL-17 has also been shown to be produced by activated CD8+ T cells and γδ T cells. Th17 cells play an important role in autoimmune diseases and resistance to bacteria and fungi. IL-17A acts on a wide range of cell types to induce the expression of cytokines, chemokines and metalloproteinases. Therefore, secretion of IL-17A promotes the inflammatory response, which leads to the recruitment of neutrophils, enhancement of antibody production, and activation of T cells. Increased IL-17A expression is seen in autoimmune diseases such as multiple sclerosis and rheumatoid arthritis. It has also been linked to asthma, psoriasis, cancer and transplant rejection.
Product OverviewThis product is a mouse antibody against IL-17A. It can be used for IL-17A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-17A/F-2; IL-17A/F-2
UniProt IDE3WEA8
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: MELPTHSICILMVICCSLRFSSCSDEGVLHPPDCNVTLQFSSEIFSLSRGNGNIHQRSMSPWRWRSTTVRHRIPSTLWEAECDSIFCSNPTSGQPKDYSLNSVPIYQNILVLNHVKGSHCYTASYHLVAVGCTCVWARSNQT.
For Research Use Only | Not For Clinical Use.
Online Inquiry