Mouse Anti-MGAT5B Antibody (CBMOAB-51260FYA)


Cat: CBMOAB-51260FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51260FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO51260FYA 100 µg
MO-AB-15626R Monoclonal Cattle (Bos taurus) WB, ELISA MO15626R 100 µg
MO-AB-59051W Monoclonal Marmoset WB, ELISA MO59051W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO51260FYA
SpecificityThis antibody binds to Rhesus MGAT5B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe MGAT5B gene encodes a beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.155) that functions in the synthesis of complex cell surface N-glycans (Kaneko et al., 2003 [PubMed 14623122]).
Product OverviewMouse Anti-Rhesus MGAT5B Antibody is a mouse antibody against MGAT5B. It can be used for MGAT5B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGAT5B
UniProt IDF7AHN1
Protein RefseqThe length of the protein is 426 amino acids long.
The sequence is show below: MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENVSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATRRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILAALYVLGHGLRVTVSLKELQRQRRLRSSQEQARCGMGDHEKMLLEDVASNTLLIEKPSKKETEKCPKNLVTWGWVGQLTPVIPALWEVMAGGLLDTRSSRPALAR.
For Research Use Only | Not For Clinical Use.
Online Inquiry