Mouse Anti-Mkrn1 Antibody (CBMOAB-24349FYA)


Cat: CBMOAB-24349FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24349FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO24349FYA 100 µg
CBMOAB-87015FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87015FYA 100 µg
MO-AB-02919Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02919Y 100 µg
MO-AB-11545W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11545W 100 µg
MO-AB-15826R Monoclonal Cattle (Bos taurus) WB, ELISA MO15826R 100 µg
MO-AB-16165Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16165Y 100 µg
MO-AB-59143W Monoclonal Marmoset WB, ELISA MO59143W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO24349FYA
SpecificityThis antibody binds to fruit fly Mkrn1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to a novel class of zinc finger proteins. The encoded protein functions as a transcriptional co-regulator, and as an E3 ubiquitin ligase that promotes the ubiquitination and proteasomal degradation of target proteins. The protein encoded by this gene is thought to regulate RNA polymerase II-catalyzed transcription. Substrates for this protein's E3 ubiquitin ligase activity include the capsid protein of the West Nile virus and the catalytic subunit of the telomerase ribonucleoprotein. This protein controls cell cycle arrest and apoptosis by regulating p21, a cell cycle regulator, and the tumor suppressor protein p53. Pseudogenes of this gene are present on chromosomes 1, 3, 9, 12 and 20, and on the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Mkrn1 Antibody is a mouse antibody against Mkrn1. It can be used for Mkrn1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD41384p; Makorin 1, isoform A; EC 6.3.2.19; Makorin 1, isoform B; EC 6.3.2.19; Makorin 1, isoform C; EC 6.3.2.19; Mkrn1
UniProt IDQ9VP20
Protein RefseqThe length of the protein is 386 amino acids long.
The sequence is show below: MSAVTSSDTAISGMALGRSQTICRYYVRGICRFGELCRFSHDLSRGRPECEEQVATDVLPKPSTSSSSTIGSRSASISSQQRNWANAPVFVPSQKRYTAHEQSEFETTVDPEAVMEAQAGASYDTLAPGVSWAEVVGGPSSLNKEDYGEENSSCAWGEFSAYPIHMELCEMCDQYCLHPTDQVQRRSHNRECLQQHEQAMELSFAIARSKDKTCGICFDTIMEKAGREKRFGILPNCNHIFCLECIRTWRQAKQFENKITRACPECRVCSDFVCPSAFWMETKEEKDKLLNDYRAALGAKDCKYFKKGEGKCPFGNKCFYKHALPNGDIVDVGLPKRTRKLQSQNEIIDLLDIYLWDYVDRRDYHWLEMISSDITSSESSDYSDED.
For Research Use Only | Not For Clinical Use.
Online Inquiry