Mouse Anti-MPDU1 Antibody (CBMOAB-51610FYA)


Cat: CBMOAB-51610FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51610FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO51610FYA 100 µg
MO-AB-10546W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10546W 100 µg
MO-AB-15932R Monoclonal Cattle (Bos taurus) WB, ELISA MO15932R 100 µg
MO-AB-27158H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27158C 100 µg
MO-AB-43286W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43286W 100 µg
MO-AB-59247W Monoclonal Marmoset WB, ELISA MO59247W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Rat (Rattus norvegicus)
CloneMO51610FYA
SpecificityThis antibody binds to Rhesus MPDU1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-P-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type If. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus MPDU1 Antibody is a mouse antibody against MPDU1. It can be used for MPDU1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMPDU1
UniProt IDF6ZDI5
Protein RefseqThe length of the protein is 146 amino acids long.
The sequence is show below: MGGAQVTEPKVSTPPPASPGSHQLPQWAHRPALSHHSLPAVWGLPGPNLHFHSGNWRSPDGWDLCGLLTLQRPHRRPAALLLECKASPQAEKGRVEPATGVIPFPLIHPTSGFSPSEPACWCDLLILHSSAFADFLSQGWLVETNG.
For Research Use Only | Not For Clinical Use.
Online Inquiry