AibGenesis™ Mouse Anti-Mrpl16 Antibody (CBMOAB-24688FYA)


Cat: CBMOAB-24688FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24688FYA Monoclonal Fruit fly (Drosophila melanogaster), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Yeast, Zebrafish (Danio rerio) WB, ELISA MO24688FYA 100 µg
CBMOAB-87362FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87362FYA 100 µg
CBMOAB-02397CR Monoclonal Yeast WB, ELISA MO02397CR 100 µg
CBMOAB-06805HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO06805HB 100 µg
MO-AB-26597W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26597W 100 µg
MO-AB-59326W Monoclonal Marmoset WB, ELISA MO59326W 100 µg
MO-AB-15989R Monoclonal Cattle (Bos taurus) WB, ELISA MO15989R 100 µg
MO-AB-27366R Monoclonal Pig (Sus scrofa) WB, ELISA MO27366R 100 µg
MO-AB-05300H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05300C 100 µg
MO-AB-27192H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27192C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Yeast, Zebrafish (Danio rerio)
CloneMO24688FYA
SpecificityThis antibody binds to fruit fly Mrpl16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Mrpl16 Antibody is a mouse antibody against Mrpl16. It can be used for Mrpl16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEG:63B12.2 protein; mRpL16; arm EG:63B12.2
UniProt IDO46082
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MLSLKLVSQLFKQSLAFCNKPLKLFFAAGNMAIVNTAGLKYFAPPIKYQNVEQPERPKLRVIERQPQLPPNIRPPKMQKRLRYMRGPEMVHNTLLHKQYAIVATGGGRLRWGHYEMMRLTIGRKMNVNTMFATWRVPAPWQPITKKGQGQRMGGGKGAIDHYVTPIKAGRVIVEIAGKCEFVEVKQFLQQVANQLPFQATVVSQEMLDEQRVAEEEQTRQNENPFTMKYVIQNNLSGCHRWLSPVDHKWFGKHL.
For Research Use Only | Not For Clinical Use.
Online Inquiry