Mouse Anti-Mt-Nd4 Antibody (CBMOAB-25320FYA)


Cat: CBMOAB-25320FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25320FYA Monoclonal Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Donkey (Equus asinus), Elephant (Loxodonta africana), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO25320FYA 100 µg
CBMOAB-87736FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87736FYA 100 µg
MO-AB-00829L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00829L 100 µg
MO-AB-08696W Monoclonal Cat (Felis catus) WB, ELISA MO08696W 100 µg
MO-AB-08890Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08890Y 100 µg
MO-AB-16182R Monoclonal Cattle (Bos taurus) WB, ELISA MO16182R 100 µg
MO-AB-31844W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31844W 100 µg
MO-AB-34274W Monoclonal Donkey (Equus asinus) WB, ELISA MO34274W 100 µg
MO-AB-45580W Monoclonal Horse (Equus caballus) WB, ELISA MO45580W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Donkey (Equus asinus), Elephant (Loxodonta africana), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO25320FYA
SpecificityThis antibody binds to fruit fly Mt-Nd4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCore subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Mt-Nd4 Antibody is a mouse antibody against Mt-Nd4. It can be used for Mt-Nd4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNADH-ubiquinone oxidoreductase chain 4; EC 1.6.5.3; Fragment
UniProt IDM4N8B8
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: INKHNNYKNLFLLNIIILLLLLILTFSSMSLFMFYLFFESSLIPTLFLILGWGYQPERLQAGLYLLFYTLLVSLPMLIGIFYVMNKIGSMNFYLMNNFMFNYDLLYFCLLCAFLVKMPMFLVHLWLPKAHVEAPVSGSMILAGIMLKLGGYGM.
For Research Use Only | Not For Clinical Use.
Online Inquiry