Mouse Anti-MYB Antibody (CBMOAB-36833FYC)
Cat: CBMOAB-36833FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36833FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Grape (Vitis vinifera), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta), Rice, Rice (Oryza), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) | WB, ELISA | MO36833FC | 100 µg | ||
CBMOAB-25199FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO25199FYA | 100 µg | ||
CBMOAB-51992FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51992FYA | 100 µg | ||
CBMOAB-87901FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87901FYA | 100 µg | ||
CBMOAB-34763FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO34763FYB | 100 µg | ||
MO-AB-04527W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04527W | 100 µg | ||
MO-AB-09852W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO09852W | 100 µg | ||
MO-AB-27122W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO27122W | 100 µg | ||
MO-AB-31853W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31853W | 100 µg | ||
MO-AB-39257W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39257W | 100 µg | ||
MO-AB-45608W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45608W | 100 µg | ||
MO-AB-59584W | Monoclonal | Marmoset | WB, ELISA | MO59584W | 100 µg | ||
MO-AB-16267R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16267R | 100 µg | ||
MO-AB-34934H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34934C | 100 µg | ||
MO-AB-03021Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03021Y | 100 µg | ||
MO-MMB-0271 | Polyclonal | Rice | ELISA, WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Grape (Vitis vinifera), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta), Rice, Rice (Oryza), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) |
Clone | MO36833FC |
Specificity | This antibody binds to Arabidopsis MYB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein with three HTH DNA-binding domains that functions as a transcription regulator. This protein plays an essential role in the regulation of hematopoiesis. This gene may be aberrently expressed or rearranged or undergo translocation in leukemias and lymphomas, and is considered to be an oncogene. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Arabidopsis MYB Antibody is a mouse antibody against MYB. It can be used for MYB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | MYB Proto-Oncogene, Transcription Factor; V-Myb Avian Myeloblastosis Viral Oncogene Homolog; Proto-Oncogene C-Myb; Transcriptional Activator Myb; Oncogene AMV; C-Myb_CDS; C-Myb; Cmyb; EFG |
UniProt ID | Q39153 |
Protein Refseq | The length of the protein is 246 amino acids long. The sequence is show below: MGRRPCCEKIGLKKGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINYLRPDIKRGNFTPHEEDTIISLHQLLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLHHSQDQNNKEDFVSTTAAEMPTSPQQQSSSSADISAITTLGNNNDISNSNKDSATSSEDVLAIIDESFWSEVVLTDCDISGNEKNEKKIENWEGSLDRNDKGYNHDMEFWFDHLTSSSCIIGEMSDISEF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry