Mouse Anti-MYB Antibody (CBMOAB-36833FYC)


Cat: CBMOAB-36833FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36833FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Grape (Vitis vinifera), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta), Rice, Rice (Oryza), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) WB, ELISA MO36833FC 100 µg
CBMOAB-25199FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO25199FYA 100 µg
CBMOAB-51992FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO51992FYA 100 µg
CBMOAB-87901FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO87901FYA 100 µg
CBMOAB-34763FYB Monoclonal Rice (Oryza) WB, ELISA MO34763FYB 100 µg
MO-AB-04527W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04527W 100 µg
MO-AB-09852W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO09852W 100 µg
MO-AB-27122W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO27122W 100 µg
MO-AB-31853W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31853W 100 µg
MO-AB-39257W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39257W 100 µg
MO-AB-45608W Monoclonal Horse (Equus caballus) WB, ELISA MO45608W 100 µg
MO-AB-59584W Monoclonal Marmoset WB, ELISA MO59584W 100 µg
MO-AB-16267R Monoclonal Cattle (Bos taurus) WB, ELISA MO16267R 100 µg
MO-AB-34934H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34934C 100 µg
MO-AB-03021Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03021Y 100 µg
MO-MMB-0271 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Grape (Vitis vinifera), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta), Rice, Rice (Oryza), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio)
CloneMO36833FC
SpecificityThis antibody binds to Arabidopsis MYB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with three HTH DNA-binding domains that functions as a transcription regulator. This protein plays an essential role in the regulation of hematopoiesis. This gene may be aberrently expressed or rearranged or undergo translocation in leukemias and lymphomas, and is considered to be an oncogene. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Arabidopsis MYB Antibody is a mouse antibody against MYB. It can be used for MYB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMYB Proto-Oncogene, Transcription Factor; V-Myb Avian Myeloblastosis Viral Oncogene Homolog; Proto-Oncogene C-Myb; Transcriptional Activator Myb; Oncogene AMV; C-Myb_CDS; C-Myb; Cmyb; EFG
UniProt IDQ39153
Protein RefseqThe length of the protein is 246 amino acids long. The sequence is show below: MGRRPCCEKIGLKKGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINYLRPDIKRGNFTPHEEDTIISLHQLLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLHHSQDQNNKEDFVSTTAAEMPTSPQQQSSSSADISAITTLGNNNDISNSNKDSATSSEDVLAIIDESFWSEVVLTDCDISGNEKNEKKIENWEGSLDRNDKGYNHDMEFWFDHLTSSSCIIGEMSDISEF.
For Research Use Only | Not For Clinical Use.
Online Inquiry