Mouse Anti-MYLPF Antibody (CBMOAB-52055FYA)


Cat: CBMOAB-52055FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52055FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO52055FYA 100 µg
MO-AB-05425H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05425C 100 µg
MO-AB-08914Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08914Y 100 µg
MO-AB-12999W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12999W 100 µg
MO-AB-16237Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16237Y 100 µg
MO-AB-16308R Monoclonal Cattle (Bos taurus) WB, ELISA MO16308R 100 µg
MO-AB-27351H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27351C 100 µg
MO-AB-27461R Monoclonal Pig (Sus scrofa) WB, ELISA MO27461R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO52055FYA
SpecificityThis antibody binds to Rhesus MYLPF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MYLPF Antibody is a mouse antibody against MYLPF. It can be used for MYLPF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMYLPF
UniProt IDF7EI96
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: XRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFWLKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFTPEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry